Opisthocomus hoazin (hoatzin): 104331888 Help Entry 104331888         CDS       T08436                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04060   Cytokine-cytokine receptor interaction oha04218   Cellular senescence oha04620   Toll-like receptor signaling pathway oha04621   NOD-like receptor signaling pathway oha04622   RIG-I-like receptor signaling pathway oha05132   Salmonella infection oha05164   Influenza A Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104331888  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104331888  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104331888    04621 NOD-like receptor signaling pathway     104331888    04622 RIG-I-like receptor signaling pathway     104331888  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104331888   09171 Infectious disease: bacterial    05132 Salmonella infection     104331888  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oha04052]     104331888    00536 Glycosaminoglycan binding proteins [BR:oha00536]     104331888 Cytokines and neuropeptides [BR:oha04052]  Cytokines   Chemokines    104331888 Glycosaminoglycan binding proteins [BR:oha00536]  Heparan sulfate / Heparin   Chemokines    104331888 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104331888 NCBI-ProteinID:  XP_009935536 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MNGKLVAVLALLLLSAAVSHGRALARMGTELRCQCIATHSKFIPPKSIQDVKLTQSGPHC KNVEVIATLKDGREVCLEPTAPWVQLIIKAILAKAQLNSDSPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaagctcgtggctgtcctggctctgctcctgctctcagcggccgtgtctcac ggcagggccctggcgaggatgggaacggagctgcggtgccagtgcatcgccactcactcc aagttcatccctcccaaatccattcaggacgtgaagctgacgcagagcggcccgcactgc aagaacgttgaagtcatagctaccctgaaggacggcagagaggtgtgcctggagcccact gctccctgggtacagctgatcatcaaggcaatcttggccaaggctcaactcaactctgac tcgccactctaa

DBGET integrated database retrieval system