Opisthocomus hoazin (hoatzin): 104332424 Help Entry 104332424         CDS       T08436                                  Symbol PFN4 Name (RefSeq) LOW QUALITY PROTEIN: profilin-4   KO K05759   profilin Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04810   Regulation of actin cytoskeleton oha05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oha00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104332424 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104332424 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oha04131]     104332424 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oha04812]     104332424 (PFN4)    04147 Exosome [BR:oha04147]     104332424 (PFN4) Membrane trafficking [BR:oha04131]  Others   Actin-binding proteins    Others     104332424 (PFN4) Cytoskeleton proteins [BR:oha04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104332424 (PFN4) Exosome [BR:oha04147]  Exosomal proteins   Proteins found in most exosomes    104332424 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104332424 NCBI-ProteinID:  XP_009936137 LinkDB All DBs Position Unknown AA seq 138 aa AA seqDB search MARVPSRRKTNQLQALLDDSLIRTKHVENMAIIGIKDAKVXASTFAFNVPPENAVNLIYA FYKNLLQVRREGLCFKGKYYKCVRADEHSIYLQNPDGGLIVVKTKTFILVATYRVGMYPT VCVEAVEKLADYFGEKGS NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcgttccctcacggaggaaaacaaaccagctgcaggctttgctggatgacagt ctcatcagaacaaagcacgtggaaaacatggccatcatcggcataaaggacgcaaaagtc tgagcatcaaccttcgcctttaatgtgccaccagagaatgctgtaaaccttatctacgct ttctacaagaacttactgcaagttagaagggaaggactctgcttcaaggggaagtactat aaatgtgtccgtgcggatgagcattccatctatcttcaaaatccagatggaggcctgata gttgtgaagacaaagacttttatcctggttgctacttacagagtgggcatgtatcccact gtgtgcgtggaagctgtggagaaactagcggactactttggagagaaaggtagctga

DBGET integrated database retrieval system