Opisthocomus hoazin (hoatzin): 104333531 Help Entry 104333531         CDS       T08436                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04010   MAPK signaling pathway oha04012   ErbB signaling pathway oha04068   FoxO signaling pathway oha04137   Mitophagy - animal oha04140   Autophagy - animal oha04150   mTOR signaling pathway oha04210   Apoptosis oha04218   Cellular senescence oha04370   VEGF signaling pathway oha04371   Apelin signaling pathway oha04540   Gap junction oha04625   C-type lectin receptor signaling pathway oha04810   Regulation of actin cytoskeleton oha04910   Insulin signaling pathway oha04912   GnRH signaling pathway oha04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104333531 (NRAS)    04012 ErbB signaling pathway     104333531 (NRAS)    04370 VEGF signaling pathway     104333531 (NRAS)    04371 Apelin signaling pathway     104333531 (NRAS)    04068 FoxO signaling pathway     104333531 (NRAS)    04150 mTOR signaling pathway     104333531 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104333531 (NRAS)    04137 Mitophagy - animal     104333531 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104333531 (NRAS)    04218 Cellular senescence     104333531 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104333531 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104333531 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104333531 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104333531 (NRAS)    04912 GnRH signaling pathway     104333531 (NRAS)    04916 Melanogenesis     104333531 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oha04131]     104333531 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104333531 (NRAS)    04031 GTP-binding proteins [BR:oha04031]     104333531 (NRAS) Membrane trafficking [BR:oha04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104333531 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104333531 (NRAS) Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104333531 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104333531 (NRAS)   Exosomal proteins of breast cancer cells    104333531 (NRAS)   Exosomal proteins of colorectal cancer cells    104333531 (NRAS) GTP-binding proteins [BR:oha04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104333531 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104333531 NCBI-ProteinID:  XP_009937347 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search LQDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINL YREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDA FYTLVREIRQYRMKKLNSSEDGNQGCMGLSCIVM NT seq 465 nt NT seq  +upstreamnt  +downstreamnt ttgcaggattcatatagaaagcaggttgttattgatggagagacgtgcttgttagacatt ctggacactgcgggacaggaagagtatagtgccatgcgtgatcagtacatgagaactggg gaaggattcctctgtgtttttgccattaacaacagtaaatcgtttgctgatattaacctt tacagagaacagatcaagagagtgaaagattcagatgatgtgccaatggtgctagtcggg aataagtgtgatttgcccacaagaacagtagacacaaaacaggctcaagaattagcaaaa agctacggaatccccttcatagagacatctgctaaaacaagacagggtgtggaagatgct ttttacacactggtgagagagatccggcagtaccggatgaaaaaactcaacagcagtgaa gatggaaatcaaggctgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system