Opisthocomus hoazin (hoatzin): 104334817 Help Entry 104334817         CDS       T08436                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04020   Calcium signaling pathway oha04070   Phosphatidylinositol signaling system oha04114   Oocyte meiosis oha04218   Cellular senescence oha04261   Adrenergic signaling in cardiomyocytes oha04270   Vascular smooth muscle contraction oha04371   Apelin signaling pathway oha04625   C-type lectin receptor signaling pathway oha04744   Phototransduction oha04910   Insulin signaling pathway oha04912   GnRH signaling pathway oha04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104334817    04020 Calcium signaling pathway     104334817    04070 Phosphatidylinositol signaling system     104334817  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104334817    04218 Cellular senescence     104334817  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104334817   09152 Endocrine system    04910 Insulin signaling pathway     104334817    04912 GnRH signaling pathway     104334817    04916 Melanogenesis     104334817   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104334817    04270 Vascular smooth muscle contraction     104334817   09157 Sensory system    04744 Phototransduction     104334817  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oha01009]     104334817   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oha04131]     104334817    03036 Chromosome and associated proteins [BR:oha03036]     104334817   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104334817 Protein phosphatases and associated proteins [BR:oha01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104334817 Membrane trafficking [BR:oha04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104334817 Chromosome and associated proteins [BR:oha03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104334817 Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104334817 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EFhand_Ca_insen EF-hand_9 EF_EFCAB10_C EF-hand_11 Dockerin_1 SPARC_Ca_bdg DUF5580_M EH FCaBP_EF-hand Motif Other DBs NCBI-GeneID:  104334817 NCBI-ProteinID:  XP_009938781 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search IDFPEFLSLMARKMRDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEGD EMIKEADCNNDGQVNYEEFVRMMTEK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atcgacttccctgagttcctctcgctgatggcgaggaagatgagggacacggacagcgag gaggagatccgtgaagctttccgcgtctttgataaggacggcaacggctacatcagcgcg gcggagctgcggcacgtcatgaccaacctgggcgagaagctgacggacgaggagggggac gagatgatcaaggaggccgactgcaacaacgatggccaggtcaactacgaggagttcgtc aggatgatgacggagaagtga

DBGET integrated database retrieval system