Opisthocomus hoazin (hoatzin): 104336542 Help Entry 104336542         CDS       T08436                                  Symbol RAP2B Name (RefSeq) ras-related protein Rap-2b   KO K07838   Ras-related protein Rap-2B Organism oha  Opisthocomus hoazin (hoatzin) Brite KEGG Orthology (KO) [BR:oha00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104336542 (RAP2B)    04031 GTP-binding proteins [BR:oha04031]     104336542 (RAP2B) Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104336542 (RAP2B) GTP-binding proteins [BR:oha04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     104336542 (RAP2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 AAA_24 Motif Other DBs NCBI-GeneID:  104336542 NCBI-ProteinID:  XP_009940687 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAG TEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIRPMRDQIIRVKR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcgggagtacaaggtggtggtgctgggctcgggcggcgtgggcaagtccgccctcacc gtccagttcgtgacgggctccttcatcgagaagtatgaccccaccatcgaggacttctac cgcaaggagatcgaggtggactcctcgccgtcggtgctagagatcctggacacggcgggc accgagcagttcgcctccatgcgggacctctacatcaagaacggccagggcttcatcctc gtctacagcctggtcaaccagcagagcttccaggacatccgacccatgcgcgaccagatc atccgcgtcaagaggtga

DBGET integrated database retrieval system