Opisthocomus hoazin (hoatzin): 104338045 Help Entry 104338045         CDS       T08436                                  Symbol TXN2 Name (RefSeq) thioredoxin, mitochondrial   KO K03671   thioredoxin Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04621   NOD-like receptor signaling pathway oha05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oha00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104338045 (TXN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104338045 (TXN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:oha03110]     104338045 (TXN2) Chaperones and folding catalysts [BR:oha03110]  Protein folding catalysts   Protein disulfide isomerase    104338045 (TXN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_3 DSBA Glrx-like Thioredoxin_9 HyaE OST3_OST6 NADH_4Fe-4S Motif Other DBs NCBI-GeneID:  104338045 NCBI-ProteinID:  XP_009942362 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search MSSSACQWCGPCKILGPRLEKVVAKQEGKVLMAKVDIDDHTDLAIEYEVSAVPTVLAMKN GDVVDKFVGIKDEDQLEAFLKKLIGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtctgcttgccagtggtgcggcccctgcaagatcctcggccccaggttagag aaggtggtggccaagcaggaggggaaggtgttgatggccaaagtggacattgatgatcac acagaccttgctatcgagtatgaggtgtcagcagtgccaaccgtgctggctatgaagaac ggagacgtcgtggacaagtttgtggggataaaggacgaggatcagctggaggcattcctc aagaaactcatcggagcctga

DBGET integrated database retrieval system