Opisthocomus hoazin (hoatzin): 104338436 Help Entry 104338436         CDS       T08436                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04081   Hormone signaling oha04144   Endocytosis oha04150   mTOR signaling pathway oha04270   Vascular smooth muscle contraction oha04310   Wnt signaling pathway oha04350   TGF-beta signaling pathway oha04510   Focal adhesion oha04517   IgSF CAM signaling oha04519   Cadherin signaling oha04520   Adherens junction oha04530   Tight junction oha04621   NOD-like receptor signaling pathway oha04625   C-type lectin receptor signaling pathway oha04810   Regulation of actin cytoskeleton oha05100   Bacterial invasion of epithelial cells oha05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104338436 (RHOA)    04350 TGF-beta signaling pathway     104338436 (RHOA)    04150 mTOR signaling pathway     104338436 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     104338436 (RHOA)    04517 IgSF CAM signaling     104338436 (RHOA)    04519 Cadherin signaling     104338436 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104338436 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104338436 (RHOA)    04520 Adherens junction     104338436 (RHOA)    04530 Tight junction     104338436 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104338436 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104338436 (RHOA)    04625 C-type lectin receptor signaling pathway     104338436 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     104338436 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104338436 (RHOA)    05100 Bacterial invasion of epithelial cells     104338436 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oha04131]     104338436 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104338436 (RHOA)    04031 GTP-binding proteins [BR:oha04031]     104338436 (RHOA) Membrane trafficking [BR:oha04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     104338436 (RHOA) Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104338436 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    104338436 (RHOA)   Exosomal proteins of colorectal cancer cells    104338436 (RHOA)   Exosomal proteins of bladder cancer cells    104338436 (RHOA) GTP-binding proteins [BR:oha04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     104338436 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  104338436 NCBI-ProteinID:  XP_009942780 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattatgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaagaagactacgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaagaaggaagagatatggcaaaccgcattggtgcatttgggtatatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system