Opisthocomus hoazin (hoatzin): 104338541 Help Entry 104338541         CDS       T08436                                  Name (RefSeq) histone H2A-IV-like   KO K11251   histone H2A Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha03082   ATP-dependent chromatin remodeling oha04217   Necroptosis Brite KEGG Orthology (KO) [BR:oha00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     104338541  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     104338541  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oha03036]     104338541   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104338541 Chromosome and associated proteins [BR:oha03036]  Eukaryotic type   Nucleosome assembly factors    Histones     104338541 Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104338541 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  104338541 NCBI-ProteinID:  XP_009942896 UniProt:  A0A091V539 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search LRKGNDAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEEL NKLLGKVTIAQGGVLPNIQAVLLPKKTDSHKAKAK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt ctgcgcaagggcaacgacgcggagcgggtgggcgccggcgccccggtgtacctggcggcc gtgctggagtacctgacggccgagatcctggagctggcgggcaacgcggcccgcgacaac aagaagacgcgcatcatcccgcgccacctgcagctggccatccgcaacgacgaggagctc aacaagctgctgggcaaggtgaccatcgcgcagggtggggtgctgcccaacatccaggcc gtgctgctgcccaagaaaactgacagccacaaggccaaggccaagtga

DBGET integrated database retrieval system