Oscillibacter hominis: H8790_01705 Help Entry H8790_01705       CDS       T11077                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ohi  Oscillibacter hominis Pathway ohi00998   Biosynthesis of various antibiotics ohi01100   Metabolic pathways ohi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ohi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H8790_01705 (acpP)    00074 Mycolic acid biosynthesis     H8790_01705 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H8790_01705 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QNL44796 UniProt:  A0A7G9B5G5 LinkDB All DBs Position 335078..335326 Genome browser AA seq 82 aa AA seqDB search MTPEEILKKLQDLIAEQFAVEAETVTMDSSFEEDLGADSVDLVELVMAIEEEFDIGEIQE EELTALKTVGDTVRYLTSKLNK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacaccggaagagattctgaaaaagctgcaggacctgattgcggagcagtttgccgtt gaggcggagactgtgaccatggattcttccttcgaggaggatctgggcgccgactctgtg gacctggttgaactggtcatggcaattgaagaagaattcgatatcggcgagatccaggaa gaagagctgaccgctctgaaaactgtgggtgacaccgttcgctatctcaccagcaagttg aataagtaa

DBGET integrated database retrieval system