Owenweeksia hongkongensis: Oweho_0668 Help Entry Oweho_0668        CDS       T01677                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oho  Owenweeksia hongkongensis Pathway oho01100   Metabolic pathways oho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Oweho_0668    00074 Mycolic acid biosynthesis     Oweho_0668   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Oweho_0668 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Spectrin_Anc-1_2 Motif Other DBs NCBI-ProteinID:  AEV31682 UniProt:  G8R111 LinkDB All DBs Position complement(709562..709819) Genome browser AA seq 85 aa AA seqDB search MTRSEIEAQLKTIIKPYVQNEEAFENLSPETDMLQDLQINSAHLVDIILDMEEHFDIEID DETAEKMLTVGEAITATENLLDKKD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacgcgctcagaaatagaggctcaactaaaaactataatcaagccttacgtgcaaaac gaggaggcctttgaaaacctttctccggaaacggatatgctacaggatttacagataaac tctgctcacttggtagatattattctggatatggaagagcatttcgacattgaaatagat gacgaaacagcggaaaaaatgctaaccgtgggagaagccattacggccactgaaaatctt ttggataaaaaggattaa

DBGET integrated database retrieval system