Owenweeksia hongkongensis: Oweho_2358 Help Entry Oweho_2358        CDS       T01677                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oho  Owenweeksia hongkongensis Pathway oho01100   Metabolic pathways oho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Oweho_2358    00074 Mycolic acid biosynthesis     Oweho_2358   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Oweho_2358 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  AEV33329 UniProt:  G8R6A9 LinkDB All DBs Position complement(2635708..2635944) Genome browser AA seq 78 aa AA seqDB search MSEIASKVKAIIVDKLGVDENEVTTEASFTNDLGADSLDTVELIMEFEKEFDIQIPDDQA ENIATVGQAVSYIEEAKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaatcgcttcaaaagtaaaagcaataatcgttgataaactgggtgtagacgaa aatgaagtaaccaccgaagcaagtttcactaacgatctaggtgcggactcattggataca gttgagcttatcatggaattcgaaaaagaattcgacattcaaattccagacgatcaggct gaaaacatcgctactgtaggacaagcagtatcgtacatcgaagaagccaaaaaataa

DBGET integrated database retrieval system