KEGG   Owenweeksia hongkongensis: Oweho_2769
Entry
Oweho_2769        CDS       T01677                                 
Name
(GenBank) putative MccF-like protein (microcin C7 resistance)
  KO
K01297  muramoyltetrapeptide carboxypeptidase [EC:3.4.17.13]
Organism
oho  Owenweeksia hongkongensis
Brite
KEGG Orthology (KO) [BR:oho00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oho01002]
    Oweho_2769
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:oho01011]
    Oweho_2769
Enzymes [BR:oho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.13  muramoyltetrapeptide carboxypeptidase
     Oweho_2769
Peptidases and inhibitors [BR:oho01002]
 Serine peptidases
  Family S66
   Oweho_2769
Peptidoglycan biosynthesis and degradation proteins [BR:oho01011]
 Precursor biosynthesis
  Carboxypeptidase
   Oweho_2769
SSDB
Motif
Pfam: Peptidase_S66 Peptidase_S66C
Other DBs
NCBI-ProteinID: AEV33731
UniProt: G8R065
LinkDB
Position
complement(3097020..3097910)
AA seq 296 aa
MITPPALKSGDTIAIISTARKISREELEPAVAEITKRGFKVLFGKNLFEEENQFSGSDTQ
RAEDLQDCMDNPKVKAILCARGGYGTVRIIDKVDFSRFANSPKWICGYSDVTVLHNKLCN
LGVESLHSTMPVNFTTNTPEALDGLFDALMGKSLAYNFESHPYNKKGVAEGKLNGGNLSM
LYSQTGSNTALQTEGAILFIEDLDEYLYHIDRMMYNLKRNGYFENLAGVIVGGMSDMNDN
TIPFGKTADEIIRDHFAEYDFPVCFGFPAGHVADNRSLIMGREVKLNVSENSSLYF
NT seq 891 nt   +upstreamnt  +downstreamnt
ttgatcacacctcctgcattaaaatcaggcgataccattgccataatatctaccgctcgc
aaaatttcgagagaagaattggagcccgctgtagcggaaataaccaaacgcggattcaag
gttctttttggcaaaaatttgtttgaagaagaaaatcaatttagcggaagcgatacccaa
agagccgaagacttacaggactgcatggacaatcctaaagtgaaagctatactatgcgct
cgcggtggttatggcacagtgcgcattattgacaaagtagattttagtcgatttgcaaat
tctccaaagtggatttgtggatacagtgatgtaactgttttacacaataagctttgtaat
cttggtgtcgaatctttgcacagcaccatgccggtaaactttaccaccaacacgcccgaa
gctctggatggtttgtttgacgctcttatggggaaatctcttgcatataatttcgaatca
catccttataataagaaaggtgtagctgaaggaaaacttaatggtggaaacctatccatg
ctttacagccaaaccggatcaaacacagctttgcaaactgagggggctattttatttata
gaagacctagatgagtatctatatcatattgataggatgatgtacaacctgaagcgaaac
gggtattttgaaaatttagctggagtgattgttggcggcatgagcgacatgaatgacaac
actattccttttggaaaaacagctgatgagataatccgagatcactttgctgaatatgat
tttccagtttgctttggttttccggctggtcatgtagcagataaccgctctttgataatg
ggcagagaagtaaagcttaatgtttcagaaaattcaagtttgtacttttag

DBGET integrated database retrieval system