Oceanobacillus iheyensis: OB0480 Help Entry OB0480            CDS       T00093                                  Name (GenBank) spore coat protein (partial)   KO K06440   similar to spore coat protein Organism oih  Oceanobacillus iheyensis Brite KEGG Orthology (KO) [BR:oih00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     OB0480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  BAC12436 JAMSTEC:  OB0480 UniProt:  Q8ESY5 LinkDB All DBs Position 508193..508333 Genome browser AA seq 46 aa AA seqDB search MDKQKLADHESMDLHEVINFKTLCLAKSKLMQGLVFDQDLRALMQT NT seq 141 nt NT seq  +upstreamnt  +downstreamnt atggataaacaaaaattagctgatcatgaatcaatggatttacatgaagttattaatttc aaaaccctgtgcttagcgaaatcaaaactaatgcaaggactcgtatttgatcaagatttg agagcattaatgcaaacttag

DBGET integrated database retrieval system