Brucella intermedia: IAR37_21405 Help Entry IAR37_21405       CDS       T06833                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism oin  Brucella intermedia Pathway oin00030   Pentose phosphate pathway oin00051   Fructose and mannose metabolism oin00710   Carbon fixation by Calvin cycle oin01100   Metabolic pathways oin01110   Biosynthesis of secondary metabolites oin01120   Microbial metabolism in diverse environments oin01200   Carbon metabolism oin01230   Biosynthesis of amino acids Module oin_M00004   Pentose phosphate pathway (Pentose phosphate cycle) oin_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:oin00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     IAR37_21405 (rpiB)    00051 Fructose and mannose metabolism     IAR37_21405 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     IAR37_21405 (rpiB) Enzymes [BR:oin01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      IAR37_21405 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB SatRNA_48 Motif Other DBs NCBI-ProteinID:  QNQ42222 LinkDB All DBs Position 2:complement(1751225..1751680) Genome browser AA seq 151 aa AA seqDB search MNIVVGSDHAGFPLKADVIEVLKELGHQVEDIGSFTPDPVDFPDIAGLLCKKVRDGSAER GILVCGTGVGAAIAANKINGIRAAVCHDVHSAHQSVEHDDVNVMCIGAKIVGSWLARDLV LSYLNARFDRNEDFVRRVEKLSALENAQSVA NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgaatattgtcgttggaagcgaccatgcgggctttccgttgaaagctgacgtgatcgag gtcctcaaagagctcggtcatcaggtggaagacattggtagcttcacgccggatcctgtc gatttccctgacatagcaggcctgctctgcaagaaggtgcgggatggttcagccgaacgt ggcattcttgtttgcgggactggcgttggcgccgccatcgcagcaaacaagatcaacggc atccgcgcagccgtctgccacgacgtccattcggcgcaccagagtgtggagcatgacgac gtgaatgtcatgtgcatcggcgcaaaaatcgtcgggtcatggctcgctcgcgacttggtc ttgtcctatctgaacgctcggtttgaccgcaacgaagatttcgtccgccgtgtcgaaaaa ctttccgcattggaaaatgcgcagtcagtcgcgtga

DBGET integrated database retrieval system