Oxyura jamaicensis (ruddy duck): 118159632 Help Entry 118159632         CDS       T11549                                  Name (RefSeq) calmodulin, striated muscle   KO K02183   calmodulin Organism oja  Oxyura jamaicensis (ruddy duck) Pathway oja04020   Calcium signaling pathway oja04070   Phosphatidylinositol signaling system oja04114   Oocyte meiosis oja04218   Cellular senescence oja04261   Adrenergic signaling in cardiomyocytes oja04270   Vascular smooth muscle contraction oja04371   Apelin signaling pathway oja04625   C-type lectin receptor signaling pathway oja04744   Phototransduction oja04910   Insulin signaling pathway oja04912   GnRH signaling pathway oja04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oja00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     118159632    04020 Calcium signaling pathway     118159632    04070 Phosphatidylinositol signaling system     118159632  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     118159632    04218 Cellular senescence     118159632  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118159632   09152 Endocrine system    04910 Insulin signaling pathway     118159632    04912 GnRH signaling pathway     118159632    04916 Melanogenesis     118159632   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     118159632    04270 Vascular smooth muscle contraction     118159632   09157 Sensory system    04744 Phototransduction     118159632  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oja01009]     118159632   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oja04131]     118159632    03036 Chromosome and associated proteins [BR:oja03036]     118159632   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oja04147]     118159632 Protein phosphatases and associated proteins [BR:oja01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      118159632 Membrane trafficking [BR:oja04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     118159632 Chromosome and associated proteins [BR:oja03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      118159632 Exosome [BR:oja04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    118159632 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  118159632 NCBI-ProteinID:  XP_035170095 LinkDB All DBs Position Unknown:2648..3097 Genome browser AA seq 149 aa AA seqDB search MAERLSEEQIAEFKEAFSLFDRDGDGCITTKELGTVMRSLGQNPTEAELQDMVGEVDADG SGTIDFPEFLSLMARKMRDSDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIKEADCNNDGQVNYEEFVRMMTEK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgagcggctgtcggaggagcagatcgccgagttcaaggaggctttttcccttttc gaccgggacggcgacggctgcatcaccaccaaggagctgggcaccgtcatgcgctcgctg gggcagaaccccaccgaggcggagctgcaggacatggtgggcgaggtggacgccgacggc agcggcaccatcgacttccccgagttcctctcgctgatggcgaggaagatgagggactcg gacagcgaggaggagatccgcgaggccttccgcgtcttcgacaaggacggcaacggctac atcagcgcggcggagctgcggcacgtcatgaccaacctgggcgagaagctgacggatgag gaggtggacgagatgatcaaggaggccgactgcaacaacgacgggcaggtcaactacgag gagttcgtgaggatgatgacggagaagtga

DBGET integrated database retrieval system