Oncorhynchus keta (chum salmon): 118364634 Help Entry 118364634         CDS       T09424                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04382   Cornified envelope formation oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118364634  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118364634  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     118364634 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of microglial cells    118364634 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DEK_C EH DAXX_hist_bd Motif Other DBs NCBI-GeneID:  118364634 NCBI-ProteinID:  XP_035602239 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSQLERSLQSLITVFHRYADKDGDCNTLSKKELKELMQTELGSFLKSQKDPAAIDKIMK NLDQNGDGMVNFEEFVSLVVDLSIACEQIYQLHTQKASAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaattggagagatccttgcagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaagaaggagctgaaagaactcatgcagaca gaactgggcagcttcctgaagtcccagaaggacccagccgccatagacaagatcatgaag aatctggaccagaatggtgatgggatggtaaacttcgaggagtttgtctctctggtggtg gacctctccatcgcctgtgaacagatctaccagctccacacccagaaggcttctgccaag aagtga

DBGET integrated database retrieval system