Oncorhynchus keta (chum salmon): 118366783 Help Entry 118366783         CDS       T09424                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04814   Motor proteins oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     118366783  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118366783  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oke03037]     118366783    04812 Cytoskeleton proteins [BR:oke04812]     118366783 Cilium and associated proteins [BR:oke03037]  Motile cilia and associated proteins   Dynein arm    118366783 Cytoskeleton proteins [BR:oke04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118366783 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Ferritin_C144_05 Motif Other DBs NCBI-GeneID:  118366783 NCBI-ProteinID:  XP_035605351 LinkDB All DBs Position 34:complement(16549597..16560194) Genome browser AA seq 115 aa AA seqDB search MEEYNSGEEVSFNADEASVSVKECIEAIIGGLDYNQNKVNQWTASIVEHSLTQLVKQGRP FKFIVNCAIMQKSGAGLHTANSCYWDTATDGSCTVRWENRTMYCVVSVFAVALTC NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggagtacaattccggagaggaggtgtccttcaacgcagatgaggccagtgtctca gttaaagagtgtatcgaagccatcattggaggactagattacaaccagaacaaagtgaac cagtggactgccagcatcgtggagcactctctcacccaactggtcaagcaagggagacca ttcaagttcatagtgaactgtgccatcatgcagaagagtggtgctggtctccacacggcc aactcctgctactgggacactgctactgatggaagctgcacggtcaggtgggagaaccgc accatgtactgtgtggtgagtgttttcgccgtggccttgacctgttaa

DBGET integrated database retrieval system