Oncorhynchus keta (chum salmon): 118370933 Help Entry 118370933         CDS       T09424                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04010   MAPK signaling pathway oke04012   ErbB signaling pathway oke04068   FoxO signaling pathway oke04137   Mitophagy - animal oke04140   Autophagy - animal oke04144   Endocytosis oke04150   mTOR signaling pathway oke04210   Apoptosis oke04218   Cellular senescence oke04370   VEGF signaling pathway oke04371   Apelin signaling pathway oke04510   Focal adhesion oke04540   Gap junction oke04625   C-type lectin receptor signaling pathway oke04810   Regulation of actin cytoskeleton oke04910   Insulin signaling pathway oke04912   GnRH signaling pathway oke04916   Melanogenesis oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118370933    04012 ErbB signaling pathway     118370933    04370 VEGF signaling pathway     118370933    04371 Apelin signaling pathway     118370933    04068 FoxO signaling pathway     118370933    04150 mTOR signaling pathway     118370933  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118370933    04140 Autophagy - animal     118370933    04137 Mitophagy - animal     118370933   09143 Cell growth and death    04210 Apoptosis     118370933    04218 Cellular senescence     118370933   09144 Cellular community - eukaryotes    04510 Focal adhesion     118370933    04540 Gap junction     118370933   09142 Cell motility    04810 Regulation of actin cytoskeleton     118370933  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118370933   09152 Endocrine system    04910 Insulin signaling pathway     118370933    04912 GnRH signaling pathway     118370933    04916 Melanogenesis     118370933  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118370933  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oke04131]     118370933   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     118370933    04031 GTP-binding proteins [BR:oke04031]     118370933 Membrane trafficking [BR:oke04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118370933  Endocytosis   Macropinocytosis    Ras GTPases     118370933 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118370933   Exosomal proteins of colorectal cancer cells    118370933 GTP-binding proteins [BR:oke04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118370933 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin G-alpha AAA_16 Motif Other DBs NCBI-GeneID:  118370933 NCBI-ProteinID:  XP_035612064 LinkDB All DBs Position 22:18950794..18988036 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggcaggaggtgtggggaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgacggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgc gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggaacagatc aagcgtgtgaaggactctgacgacgtaccgatggtgctggtgggtaataaatgtgacctc ccggcttgtaccgtggacacgcggcaagcccaggaactggcccgcagctatggaattccc tacattgagacctcggccaagacacgacagggggtagaggatgccttctacacactagtc agagagatcaggcaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac tgcatgagctgccgctgtgtggtgtcttga

DBGET integrated database retrieval system