Oncorhynchus keta (chum salmon): 118372896 Help Entry 118372896         CDS       T09424                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oke00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118372896  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oke04121]     118372896    03400 DNA repair and recombination proteins [BR:oke03400]     118372896 Ubiquitin system [BR:oke04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      118372896    Cul5 complex      118372896 DNA repair and recombination proteins [BR:oke03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118372896 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118372896 NCBI-ProteinID:  XP_035614823 LinkDB All DBs Position 5:complement(24265652..24270110) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgaactgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggctgtacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaatcagacagccagacctcaggccccagggactgttggattagctttccgt ctcggtgatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctt cctgatgtcatgaagcctcaggactctggcagcacagccaatgagcaggctgtgcagtga

DBGET integrated database retrieval system