Oncorhynchus keta (chum salmon): 118374926 Help Entry 118374926         CDS       T09424                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04137   Mitophagy - animal oke04140   Autophagy - animal oke04144   Endocytosis oke04145   Phagosome oke04148   Efferocytosis oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118374926    04145 Phagosome     118374926    04140 Autophagy - animal     118374926    04137 Mitophagy - animal     118374926    04148 Efferocytosis     118374926  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118374926  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oke04131]     118374926   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     118374926    04031 GTP-binding proteins [BR:oke04031]     118374926 Membrane trafficking [BR:oke04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118374926 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118374926   Exosomal proteins of other body fluids (saliva and urine)    118374926   Exosomal proteins of colorectal cancer cells    118374926   Exosomal proteins of bladder cancer cells    118374926 GTP-binding proteins [BR:oke04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118374926 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 Septin AAA_22 AAA_24 AAA_7 DUF5992 AAA_5 ATPase_2 SRPRB NACHT ABC_tran NB-ARC Motif Other DBs NCBI-GeneID:  118374926 NCBI-ProteinID:  XP_035617311 LinkDB All DBs Position 9:24520638..24524985 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRSSSSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctcccgtaagaaggtgctgctgaaggtgatcatcctcggagactctggggtaggg aagacatctctgatgaaccagtatgtaaataagaggttcagtaaccaatacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggatgacaggctggtcaccatgcag atctgggacacggctgggcaggagcggtttcaatctctgggtgtggcgttctaccgtggg gctgactgctgtgtgctggtctatgatgtcacggcgcccaacacctttaagactctggac agttggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacaacaaagcgtgcccag gcctggtgtgccagtaagaacaacatcccctactttgagaccagtgccaaggaggccatc aacgtagatcaagcattccagaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtatgactttccagaccagatcaaactgagagatgaccggtcctcctcctccagc gacggctgctcctgctga

DBGET integrated database retrieval system