Oncorhynchus keta (chum salmon): 118388284 Help Entry 118388284         CDS       T09424                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism oke  Oncorhynchus keta (chum salmon) Pathway oke03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:oke00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     118388284 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oke03036]     118388284 (cenps)    03400 DNA repair and recombination proteins [BR:oke03400]     118388284 (cenps) Chromosome and associated proteins [BR:oke03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      118388284 (cenps) DNA repair and recombination proteins [BR:oke03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      118388284 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP Histone Anti-adapt_IraP Motif Other DBs NCBI-GeneID:  118388284 NCBI-ProteinID:  XP_035633063 LinkDB All DBs Position 10:16122090..16125425 Genome browser AA seq 139 aa AA seqDB search MLSTTSCRANVNCREKMATAMDEEERKLQRLKAAVHYTVGRLCQSIGEDHQKEFSRQVIA AIAETTFRQCDIFAKDLEAFARHAKRSTVSVEDVKLTARRSTALSNFIQRKSEEIASANQ EQRDTRKKIAGKRKNTEMV NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgctatccactactagctgccgagctaacgtgaactgtcgggagaaaatggcaacagca atggacgaggaggaaagaaaacttcagagactgaaagcagcagtccactatacagtggga agactgtgtcaaagcattggtgaggatcatcagaaggaattcagtcgacaggttatagca gcaatagctgaaacgacattcaggcaatgtgatatttttgcaaaggacttggaggccttt gcaaggcatgccaaaagaagcacagtatctgtagaggatgtgaagcttacagctcgtcga agtacagcactgtctaacttcatacaaaggaagagtgaagagattgccagcgccaaccag gagcagagagacacaaggaagaagattgcagggaagaggaagaatacagagatggtgtag

DBGET integrated database retrieval system