Oncorhynchus keta (chum salmon): 118392643 Help Entry 118392643         CDS       T09424                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04060   Cytokine-cytokine receptor interaction oke04218   Cellular senescence oke04620   Toll-like receptor signaling pathway oke04621   NOD-like receptor signaling pathway oke04622   RIG-I-like receptor signaling pathway oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     118392643  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     118392643  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118392643    04621 NOD-like receptor signaling pathway     118392643    04622 RIG-I-like receptor signaling pathway     118392643  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118392643  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oke04052]     118392643    00536 Glycosaminoglycan binding proteins [BR:oke00536]     118392643 Cytokines and neuropeptides [BR:oke04052]  Cytokines   Chemokines    118392643 Glycosaminoglycan binding proteins [BR:oke00536]  Heparan sulfate / Heparin   Chemokines    118392643 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  118392643 NCBI-ProteinID:  XP_035640577 LinkDB All DBs Position 13:24554610..24557251 Genome browser AA seq 115 aa AA seqDB search MNTASITIILLTLLSIFSTTEGINQPRVLRCLCPKVQAGLIPFRDLKSVWHLSPRPHCSK TEVIVTLKRGGQLCLDPKKRLVKILVERSTKRMQESNRSKEVGSVTPALLHLSTR NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgaacaccgcaagcataaccatcattctgctcacccttctgtccatcttctcaacaact gaagggataaatcaaccacgggttctacgctgcctttgccccaaagtgcaggctggtctt attccgttcagggatttgaagagtgtgtggcacctctctcctcgcccacactgttcaaag actgaagtcattgtcacactcaaaaggggaggtcaactctgcctggacccaaagaaacgt ttggtgaagattctggtggagagatcaaccaaaagaatgcaggaaagcaatcgttctaaa gaggttggaagcgtcactcctgccctgttacacttgtcaaccagatga

DBGET integrated database retrieval system