Oncorhynchus keta (chum salmon): 118397418 Help Entry 118397418         CDS       T09424                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism oke  Oncorhynchus keta (chum salmon) Pathway oke03272   Virion - Hepatitis viruses oke04382   Cornified envelope formation oke04514   Cell adhesion molecules oke04530   Tight junction Brite KEGG Orthology (KO) [BR:oke00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     118397418  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     118397418  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     118397418  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118397418  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oke03037]     118397418    04147 Exosome [BR:oke04147]     118397418    04515 Cell adhesion molecules [BR:oke04515]     118397418 Cilium and associated proteins [BR:oke03037]  Other cilia and associated proteins   Stereociliary proteins    118397418 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    118397418   Exosomal proteins of colorectal cancer cells    118397418 Cell adhesion molecules [BR:oke04515]  Immunoglobulin superfamily   L1 family    118397418 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin DUF7139 MFS_MOT1 Claudin_2 zf_Rg YtpI Motif Other DBs NCBI-GeneID:  118397418 NCBI-ProteinID:  XP_052323562 LinkDB All DBs Position 18:20308975..20312462 Genome browser AA seq 143 aa AA seqDB search MSCVVQSTGQMQFKVYDSMMSLSSDLQVARVLVMVDIVVGIAGLFMAFVGGKCTNFLLEE VAKARATVAVGVVLIISGILCLIPVSSTASLIIQDFYNRLSGESWEAGILLLLGGGLLCG NCHPKEDDKAPSVKYILAKSSGS NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgagctgtgtggtccagagcacgggccagatgcagtttaaggtatatgactccatgatg tccctcagctccgacctgcaggttgctagagtgctggtcatggtggacatcgtggtggga attgctggcctcttcatggcgtttgtcggggggaagtgcaccaacttcctgttggaggag gtggccaaggcacgggcgacggtggcggtaggggtggtgctcatcatcagtgggatcctg tgtctcatccctgtatcctcaacagccagtctcatcatccaggacttttacaatcgactc agcggagagagctgggaggctgggatcctgctactcctgggagggggactcctctgtggt aactgccaccccaaggaggacgacaaagccccctctgtgaaatatatactggccaagtcg tcaggaagttaa

DBGET integrated database retrieval system