Oncorhynchus keta (chum salmon): 118397451 Help Entry 118397451         CDS       T09424                                  Symbol dynll2a Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04517   IgSF CAM signaling oke04814   Motor proteins oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     118397451 (dynll2a)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     118397451 (dynll2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118397451 (dynll2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oke03037]     118397451 (dynll2a)    04812 Cytoskeleton proteins [BR:oke04812]     118397451 (dynll2a) Cilium and associated proteins [BR:oke03037]  Motile cilia and associated proteins   Dynein arm    118397451 (dynll2a) Cytoskeleton proteins [BR:oke04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118397451 (dynll2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  118397451 NCBI-ProteinID:  XP_035648088 LinkDB All DBs Position 18:complement(21500915..21503445) Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgacaggaaggcagtaatcaagaatgctgacatgtctgaggacatgcagcaggat gcagtggactgtgctacccaggccatggagaagtacaatatagaaaaggacattgcagcc tacataaagaaggaatttgacaagaagtataaccctacatggcattgcattgttggaagg aacttcggcagctacgtcactcatgagacaaagcatttcatctacttctacttagggcag gtggccatcctcctcttcaagtctggctga

DBGET integrated database retrieval system