Oncorhynchus keta (chum salmon): 118399108 Help Entry 118399108         CDS       T09424                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04382   Cornified envelope formation oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     118399108  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118399108  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     118399108 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of microglial cells    118399108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd NNH2 Bcl-2 EH Motif Other DBs NCBI-GeneID:  118399108 NCBI-ProteinID:  XP_035650801 LinkDB All DBs Position 20:854510..856843 Genome browser AA seq 99 aa AA seqDB search MPSDLERAMESMITVFHKYAAKEGSGNTLSRRELKDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgtcagacctggaacgtgccatggagtccatgatcaccgtgttccacaagtacgct gctaaggagggcagtggcaacactttgagccgccgtgagctcaaggacctgatggagaac gagctctctggcttcctcaagtctcagaaggatccggccacagtagacaagatcatgaag gatctggactctaatggtgatggagaggtgaactttgaggagtttgtttctctagttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system