Oncorhynchus keta (chum salmon): 118400317 Help Entry 118400317         CDS       T09424                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04137   Mitophagy - animal oke04140   Autophagy - animal oke04144   Endocytosis oke04145   Phagosome oke04148   Efferocytosis oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118400317    04145 Phagosome     118400317    04140 Autophagy - animal     118400317    04137 Mitophagy - animal     118400317    04148 Efferocytosis     118400317  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118400317  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oke04131]     118400317   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     118400317    04031 GTP-binding proteins [BR:oke04031]     118400317 Membrane trafficking [BR:oke04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118400317 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118400317   Exosomal proteins of other body fluids (saliva and urine)    118400317   Exosomal proteins of colorectal cancer cells    118400317   Exosomal proteins of bladder cancer cells    118400317 GTP-binding proteins [BR:oke04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118400317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_7 AAA_24 NTPase_1 AAA_5 ATPase_2 NACHT ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  118400317 NCBI-ProteinID:  XP_035652915 LinkDB All DBs Position 21:24442692..24466569 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKDNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAEACSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccaggaagaaagtgctcctgaaagtcatcatccttggggattctggagttggg aagacctccctgatgaaccagtatgtgaataggaagttcagtaaccagtacaaagccaca ataggagctgacttcctgaccaaggaggtgatggtggacgatcggctcgtcacaatgcag atctgggacacggcagggcaggagaggttccagtctctgggtgtggcgttctaccgcggg gcagactgctgtgtgctggtgtttgatgtgactgctcctaacaccttcaagactctagac agctggagggacgagttcctcatccaggccagtcccagggaccccgagaacttccctttt gtggtgctaggcaacaagatcgacctggagaacagacaggtgacgaccaagcgagctcag gcatggtgtcagagtaaggacaacatcccctactttgagaccagtgctaaggaggccatc aacgtagagcaggccttccagaccatcgcacgcaatgccctcaaacaggagacggaggtg gagctgtataatgaattcccagaacccataaagctggacaggaatgatcgagcaaagcct tcagcagaggcctgcagctgctga

DBGET integrated database retrieval system