Oncorhynchus keta (chum salmon): 127917762 Help Entry 127917762         CDS       T09424                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism oke  Oncorhynchus keta (chum salmon) Pathway oke03082   ATP-dependent chromatin remodeling oke04217   Necroptosis Brite KEGG Orthology (KO) [BR:oke00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     127917762  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127917762  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oke03036]     127917762   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     127917762 Chromosome and associated proteins [BR:oke03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127917762 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127917762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  127917762 NCBI-ProteinID:  XP_052356786 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKAVKAK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggaagaggcaaaaccggaggcaaggccagggcgaaggcaaagacacgttcatcc cgtgccgggctccagttccccgtgggccgtgtgcacaggctgctgcgcaaaggcaactac gccgagcgtgtgggcgctggcgcaccagtctacctggccgcagtgctcgagtacctgact gctgagatcctggagttggccggaaacgctgcccgtgacaacaagaagactcgtatcatc ccccgtcacctgcagctggcagtccgtaacgacgaggagctgaacaaactgcttggcggc gtgaccatcgctcagggtggtgttctgcccaacatccaggcagtgctgctccccaagaag actgagaaggccgtcaaagccaagtaa

DBGET integrated database retrieval system