Oncorhynchus keta (chum salmon): 127927432 Help Entry 127927432         CDS       T09424                                  Name (RefSeq) profilin-2-like   KO K05759   profilin Organism oke  Oncorhynchus keta (chum salmon) Pathway oke04810   Regulation of actin cytoskeleton oke05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oke00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127927432  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127927432  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oke04131]     127927432   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oke04812]     127927432    04147 Exosome [BR:oke04147]     127927432 Membrane trafficking [BR:oke04131]  Others   Actin-binding proteins    Others     127927432 Cytoskeleton proteins [BR:oke04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      127927432 Exosome [BR:oke04147]  Exosomal proteins   Proteins found in most exosomes    127927432 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin DUF7444 Motif Other DBs NCBI-GeneID:  127927432 NCBI-ProteinID:  XP_052369822 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MRARRSQAAEIKAMMSLDRSPLFASGLHLSGNKCTVLRDNLHIDGDNTLDVKMRPTATDA LSYSITIAKTGQTLIIVKGMKDIPGGKINIKASDMMHYLRKIDLYPLTSP NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgagggcccgacgttcacaggctgcagagatcaaggcgatgatgtcgttggatcgttct cctctcttcgccagcggtcttcatctcagtgggaacaagtgtactgtcctgagagataat ctccacattgatggggacaacactttagatgttaagatgaggcccactgctactgatgcc ctctcctacagcatcaccatcgcaaagactggccagactctgatcattgttaaagggatg aaggacattcccggaggaaagatcaacataaaggcctccgacatgatgcattacctgagg aagattgacctctaccccctgacctccccctga

DBGET integrated database retrieval system