Oncorhynchus keta (chum salmon): 127930074 Help Entry 127930074         CDS       T09424                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism oke  Oncorhynchus keta (chum salmon) Brite KEGG Orthology (KO) [BR:oke00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:oke03019]     127930074 (mt2)    03029 Mitochondrial biogenesis [BR:oke03029]     127930074 (mt2) Messenger RNA biogenesis [BR:oke03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      127930074 (mt2) Mitochondrial biogenesis [BR:oke03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     127930074 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  127930074 NCBI-ProteinID:  XP_052375138 LinkDB All DBs Position 5:complement(24053621..24055808) Genome browser AA seq 62 aa AA seqDB search MDPCNCSKTGSCSCGGLCKCTNCECAKKSKCMFCSCCPTGCSKCASGCVCKEGKTCDTSC CQ NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggatccttgtaattgctcaaaaactggaagctgcagttgcggtggactctgcaagtgt acaaactgcgaatgtgccaagaaaagtaagtgcatgttttgttcctgttgcccgactgga tgcagcaagtgcgcctctggttgcgtgtgcaaggagggcaagacgtgtgacacaagctgc tgtcagtga

DBGET integrated database retrieval system