Oncorhynchus kisutch (coho salmon): 109867329 Help Entry 109867329         CDS       T09179                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04020   Calcium signaling pathway oki04070   Phosphatidylinositol signaling system oki04114   Oocyte meiosis oki04218   Cellular senescence oki04261   Adrenergic signaling in cardiomyocytes oki04270   Vascular smooth muscle contraction oki04371   Apelin signaling pathway oki04625   C-type lectin receptor signaling pathway oki04744   Phototransduction oki04910   Insulin signaling pathway oki04912   GnRH signaling pathway oki04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     109867329    04020 Calcium signaling pathway     109867329    04070 Phosphatidylinositol signaling system     109867329  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109867329    04218 Cellular senescence     109867329  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109867329   09152 Endocrine system    04910 Insulin signaling pathway     109867329    04912 GnRH signaling pathway     109867329    04916 Melanogenesis     109867329   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109867329    04270 Vascular smooth muscle contraction     109867329   09157 Sensory system    04744 Phototransduction     109867329  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oki01009]     109867329   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oki04131]     109867329    03036 Chromosome and associated proteins [BR:oki03036]     109867329   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109867329 Protein phosphatases and associated proteins [BR:oki01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109867329 Membrane trafficking [BR:oki04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109867329 Chromosome and associated proteins [BR:oki03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109867329 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109867329 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 AIF-1 EF-hand_9 EF-hand_5 Motif Other DBs NCBI-GeneID:  109867329 NCBI-ProteinID:  XP_020312029 Ensembl:  ENSOKIG00005039699 LinkDB All DBs Position LG22:complement(7327809..7340940) Genome browser AA seq 153 aa AA seqDB search MAKFLTQDQINEFKECFSLYDKKHKGKIEAKDLIIVMRCLGVSPTFIEVDRHLQISKIDK CGELDFSTFLTMMHQQIQQEDPRAEILEAMRMTDKQKKGYILSSELRAKLTGLGEKLTDK EVDELLKETGVGPDGCVHYEEFAKTMTLPSTNC NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggcaaagttcctgactcaagaccaaataaatgaattcaaggaatgcttttcactctat gacaagaagcacaagggtaaaattgaggccaaggacctgattatagtcatgcgctgcctg ggggtcagccccactttcattgaggtggacagacacctgcaaatctccaagattgataag tgtggagagctggacttctccaccttcctgactatgatgcaccagcagatccagcaggag gaccccagagcagagattctggaggccatgaggatgacggacaagcagaagaagggctac atcctgtcctcggagctccgggccaagctcaccgggctgggagagaagctcactgataaa gaagttgacgagctgctgaaagagactggcgtgggaccagacggatgtgtccactatgag gagtttgccaaaacaatgacccttccttctacaaactgctga

DBGET integrated database retrieval system