Oncorhynchus kisutch (coho salmon): 109867777 Help Entry 109867777         CDS       T09179                                  Name (RefSeq) GTPase HRas isoform X2   KO K02833   GTPase HRas Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04012   ErbB signaling pathway oki04068   FoxO signaling pathway oki04137   Mitophagy - animal oki04140   Autophagy - animal oki04144   Endocytosis oki04150   mTOR signaling pathway oki04210   Apoptosis oki04218   Cellular senescence oki04370   VEGF signaling pathway oki04371   Apelin signaling pathway oki04510   Focal adhesion oki04540   Gap junction oki04625   C-type lectin receptor signaling pathway oki04810   Regulation of actin cytoskeleton oki04910   Insulin signaling pathway oki04912   GnRH signaling pathway oki04916   Melanogenesis oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109867777    04012 ErbB signaling pathway     109867777    04370 VEGF signaling pathway     109867777    04371 Apelin signaling pathway     109867777    04068 FoxO signaling pathway     109867777    04150 mTOR signaling pathway     109867777  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109867777    04140 Autophagy - animal     109867777    04137 Mitophagy - animal     109867777   09143 Cell growth and death    04210 Apoptosis     109867777    04218 Cellular senescence     109867777   09144 Cellular community - eukaryotes    04510 Focal adhesion     109867777    04540 Gap junction     109867777   09142 Cell motility    04810 Regulation of actin cytoskeleton     109867777  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109867777   09152 Endocrine system    04910 Insulin signaling pathway     109867777    04912 GnRH signaling pathway     109867777    04916 Melanogenesis     109867777  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109867777  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oki04131]     109867777   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109867777    04031 GTP-binding proteins [BR:oki04031]     109867777 Membrane trafficking [BR:oki04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     109867777  Endocytosis   Macropinocytosis    Ras GTPases     109867777 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109867777   Exosomal proteins of colorectal cancer cells    109867777 GTP-binding proteins [BR:oki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109867777 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin AAA_16 Motif Other DBs NCBI-GeneID:  109867777 NCBI-ProteinID:  XP_020312648 Ensembl:  ENSOKIG00005038046 LinkDB All DBs Position LG22:complement(33217570..33246704) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcatac aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtcctttgaggacatccaccagtacagggaacagatt aagcgtgtgaaagactctgacgacgtgcccatggtcctggtgggtaataaatgtgacctc ccatcgcgtaccgtggacactcggcaagcacaggaactagcccgcagctacggaattccc tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgctagtg agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac tgcatgagctgccgctgtgtggtgtcgtga

DBGET integrated database retrieval system