Oncorhynchus kisutch (coho salmon): 109868139 Help Entry 109868139         CDS       T09179                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04137   Mitophagy - animal oki04140   Autophagy - animal oki04144   Endocytosis oki04145   Phagosome oki04148   Efferocytosis oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109868139    04145 Phagosome     109868139    04140 Autophagy - animal     109868139    04137 Mitophagy - animal     109868139    04148 Efferocytosis     109868139  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109868139  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oki04131]     109868139   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109868139    04031 GTP-binding proteins [BR:oki04031]     109868139 Membrane trafficking [BR:oki04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109868139 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109868139   Exosomal proteins of other body fluids (saliva and urine)    109868139   Exosomal proteins of colorectal cancer cells    109868139   Exosomal proteins of bladder cancer cells    109868139 GTP-binding proteins [BR:oki04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109868139 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA cobW ATP_bind_1 nSTAND3 PduV-EutP AAA_16 NTPase_1 Septin AAA_22 AAA_24 AAA_7 DUF5992 AAA_5 ATPase_2 SRPRB NACHT ABC_tran NB-ARC Motif Other DBs NCBI-GeneID:  109868139 NCBI-ProteinID:  XP_020313189 Ensembl:  ENSOKIG00005029423 LinkDB All DBs Position LG23:complement(28233464..28238000) Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKRFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPDNFPF VVLGNKIDLENRQVTTKRAQAWCASKNNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRSSSSSDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcctctcgtaagaaggtgctgctgaaggtgatcattctcggagactctggggtaggg aagacatctctgatgaaccagtatgtaaataagaggttcagtaaccaatacaaggccact ataggagctgacttcctcaccaaggaggtgatggtggatgacaggctggtcaccatgcag atctgggacacggctgggcaggagcggtttcaatctctgggtgtggcgttctaccgtggg gctgactgttgtgtgctggtctatgatgtcacggcgcccaacacctttaagactctggac agttggagggatgagttcctgatccaggccagccccagagacccagataacttccccttt gtggtgctaggcaacaagattgacctcgagaacagacaggtgacaacaaagcgtgcccag gcctggtgtgccagtaagaacaacatcccctactttgagaccagtgccaaggaggccatc aacgtagaccaagcattccagaccatcgcccgcaacgccctcaaacaggagtctgaggtg gagacgtatgactttccagaccagatcaaactgagagatgaccggtcctcctcctccagc gacggctgctcctgctga

DBGET integrated database retrieval system