Oncorhynchus kisutch (coho salmon): 109875972 Help Entry 109875972         CDS       T09179                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04814   Motor proteins oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     109875972  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109875972  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:oki03037]     109875972    04812 Cytoskeleton proteins [BR:oki04812]     109875972 Cilium and associated proteins [BR:oki03037]  Motile cilia and associated proteins   Dynein arm    109875972 Cytoskeleton proteins [BR:oki04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109875972 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 TPR_ATM Motif Other DBs NCBI-GeneID:  109875972 NCBI-ProteinID:  XP_020324018 LinkDB All DBs Position LG16:51927886..51930825 Genome browser AA seq 114 aa AA seqDB search MEEFSVEEGSFNSEEASNSVKECIQNIIGEESYRQDTVNQWTAKIVEQALTLLVKQTKSY KYIVSCAVMQKSGAGLHTANSCYWDTVTDGSCTVKWENRTMYCVVSVFAVALTP NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggaattttctgttgaagagggctctttcaactctgaagaggccagtaactccgtg aaagagtgtattcagaatatcattggagaagagagctacagacaggacactgtgaaccag tggacagccaagattgtggagcaagccctcaccctgctggtcaaacagactaagtcatac aagtacattgttagctgtgctgtcatgcagaagagtggtgctggtctccacacagctaac tcctgctactgggacactgttactgatgggagctgcacagtgaaatgggagaaccgcacc atgtactgtgtggtcagtgtgtttgctgtggccttaaccccctag

DBGET integrated database retrieval system