Oncorhynchus kisutch (coho salmon): 109879294 Help Entry 109879294         CDS       T09179                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04068   FoxO signaling pathway oki04136   Autophagy - other oki04140   Autophagy - animal oki04621   NOD-like receptor signaling pathway oki04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     109879294  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109879294    04136 Autophagy - other     109879294  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109879294    04622 RIG-I-like receptor signaling pathway     109879294  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oki04131]     109879294    04121 Ubiquitin system [BR:oki04121]     109879294    03029 Mitochondrial biogenesis [BR:oki03029]     109879294 Membrane trafficking [BR:oki04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     109879294 Ubiquitin system [BR:oki04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    109879294 Mitochondrial biogenesis [BR:oki03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     109879294 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  109879294 NCBI-ProteinID:  XP_020327064 Ensembl:  ENSOKIG00005017237 UniProt:  A0A8C7GC88 LinkDB All DBs Position LG2:complement(5541342..5545286) Genome browser AA seq 140 aa AA seqDB search MQRFPHNECVSESSALGLLRMSDKAESPTETQKDEPSTPQQPTEDSGMADDKKKIDVLLK AVGDTPIMKTKKWSVEKGRTVQSLSQFISRFLKMEANEQLFIYVNQSFSPSPDQEVGVLF QCFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgcagcgttttccccataacgagtgcgtgtcagaatcaagtgcactaggactgctgagg atgtctgacaaggcagagtctcccacagaaacgcaaaaagatgagccttcaaccccacaa cagcctacggaagactcggggatggcagacgataagaaaaaaattgacgtgttgttgaag gcagtaggagacacccccatcatgaagacaaagaaatggtcggtagagaaagggaggaca gtgcaatcactctctcaattcatctctcgattcctcaagatggaggccaatgaacagctg ttcatttacgtcaaccagtcattctctccctcgcctgatcaggaagtaggagtcctgttt caatgttttggcagcgatgggaagcttgttctacattactgtaaatctcaagcctggggt taa

DBGET integrated database retrieval system