Oncorhynchus kisutch (coho salmon): 109885175 Help Entry 109885175         CDS       T09179                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04382   Cornified envelope formation oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109885175  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109885175  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109885175 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of microglial cells    109885175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 DAXX_hist_bd EH HalOD1 Astro_p19 Motif Other DBs NCBI-GeneID:  109885175 NCBI-ProteinID:  XP_020332625 Ensembl:  ENSOKIG00005000196 UniProt:  A0A8C7C1W9 LinkDB All DBs Position LG2:3029193..3031675 Genome browser AA seq 101 aa AA seqDB search MPSQLESSMESLITVFHRYADKDGDCNTLSKKELKDLMQTELASFLKSQKDPAAIDKIMK DLDQNGDGKVSFEEFVSLVVGLSIACEQIYQLHTQKVAAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcagttggagagttccatggagtccctgatcacggtgttccatcgctatgcc gacaaggacggtgactgtaacacactgagcaagaaggagctgaaagacctgatgcagaca gaactggccagcttcctgaagtcccagaaggacccagccgctatagacaagatcatgaag gatctggaccagaatggtgatgggaaggtgagcttcgaggagtttgtctctctggtggtg ggcctctccattgcctgtgaacagatctaccagctccacacccaaaaggttgctgccaag aagtga

DBGET integrated database retrieval system