Oncorhynchus kisutch (coho salmon): 109885507 Help Entry 109885507         CDS       T09179                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04382   Cornified envelope formation oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109885507  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109885507  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109885507 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of microglial cells    109885507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_5 EF-hand_6 Astro_p19 DUF826 HalOD1 Motif Other DBs NCBI-GeneID:  109885507 NCBI-ProteinID:  XP_020332943 Ensembl:  ENSOKIG00005000196 LinkDB All DBs Position LG2:2956557..2957984 Genome browser AA seq 101 aa AA seqDB search MPSELERSMESLIMVFYRYAEKDGDGNTLSKKELKELMKTELASFLKSQKDPAAIDTIMK DLDQNGDGKVSFEEFVSLVVGLSIACEQIYQLHTQKVVAKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccgtctgagttggagcgttccatggagtccctgatcatggtgttctatcgctatgct gaaaaggatggtgacggcaacacactgagcaagaaggagctcaaagagctgatgaagaca gaactggccagcttcctgaagtcccagaaggacccagccgccatagacacaatcatgaag gatctggaccagaatggtgatgggaaggtgagctttgaggagtttgtctctctggtggtg ggcctctccattgcctgtgaacagatctaccagctccacacccaaaaggttgttgccaag aagtga

DBGET integrated database retrieval system