Oncorhynchus kisutch (coho salmon): 109892188 Help Entry 109892188         CDS       T09179                                  Name (RefSeq) insulin   KO K04526   insulin Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04068   FoxO signaling pathway oki04081   Hormone signaling oki04114   Oocyte meiosis oki04140   Autophagy - animal oki04150   mTOR signaling pathway oki04810   Regulation of actin cytoskeleton oki04910   Insulin signaling pathway oki04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     109892188    04150 mTOR signaling pathway     109892188   09133 Signaling molecules and interaction    04081 Hormone signaling     109892188  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109892188  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oki04052]     109892188 Cytokines and neuropeptides [BR:oki04052]  Neuropeptides   Unclassified    109892188 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  109892188 NCBI-ProteinID:  XP_020340217 Ensembl:  ENSOKIG00005007180 LinkDB All DBs Position LG6:56514439..56515689 Genome browser AA seq 105 aa AA seqDB search MAFWLQAASLLVLLALSPGADAAAAQHLCGSHLVDALYLVCGEKGFFYNPKRDVDPLIGF FSPKSAKENEEYPFKDQMEIMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccttctggctccaagctgcatctctgctggtgctgctagcgctctcccccggggca gacgctgcagccgcccagcacctgtgtggctctcacctggtggacgccctctatctggtg tgtggagagaaaggattcttttacaacccaaagagagatgtggatccccttatagggttc ttctctccaaaatcagcaaaggagaacgaagagtaccccttcaaagaccagatggagata atggtaaagagaggtattgtagagcagtgctgtcacaagccctgcaacatcttcgacctg caaaactactgcaactga

DBGET integrated database retrieval system