Oncorhynchus kisutch (coho salmon): 109893083 Help Entry 109893083         CDS       T09179                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04137   Mitophagy - animal oki04140   Autophagy - animal oki04218   Cellular senescence oki04371   Apelin signaling pathway oki04625   C-type lectin receptor signaling pathway oki04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109893083 (rras)    04371 Apelin signaling pathway     109893083 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109893083 (rras)    04137 Mitophagy - animal     109893083 (rras)   09143 Cell growth and death    04218 Cellular senescence     109893083 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109893083 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109893083 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109893083 (rras)    04031 GTP-binding proteins [BR:oki04031]     109893083 (rras) Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109893083 (rras)   Exosomal proteins of bladder cancer cells    109893083 (rras) GTP-binding proteins [BR:oki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109893083 (rras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  109893083 NCBI-ProteinID:  XP_020341703 Ensembl:  ENSOKIG00005031098 UniProt:  A0A8C7IH74 LinkDB All DBs Position LG6:60807673..60824488 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRAISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggcggtgtggggaaa agcgccttgaccatacaattcattcagtcatactttgtatcggattatgaccccaccatc gaggactcctacaccaagatatgcacagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaggaggagtttggggcaatgagggagcagtacatgcgctcaggggaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagcgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcggtggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system