Oncorhynchus kisutch (coho salmon): 109893083 Help Entry 109893083         CDS       T09179                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04137   Mitophagy - animal oki04140   Autophagy - animal oki04218   Cellular senescence oki04371   Apelin signaling pathway oki04519   Cadherin signaling oki04625   C-type lectin receptor signaling pathway oki04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109893083 (rras)    04371 Apelin signaling pathway     109893083 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     109893083 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109893083 (rras)    04137 Mitophagy - animal     109893083 (rras)   09143 Cell growth and death    04218 Cellular senescence     109893083 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109893083 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109893083 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109893083 (rras)    04031 GTP-binding proteins [BR:oki04031]     109893083 (rras) Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109893083 (rras)   Exosomal proteins of bladder cancer cells    109893083 (rras) GTP-binding proteins [BR:oki04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109893083 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF192 EVI5 Motif Other DBs NCBI-GeneID:  109893083 NCBI-ProteinID:  XP_020341703 Ensembl:  ENSOKIG00005031098 UniProt:  A0A8C7IH74 LinkDB All DBs Position LG6:60807673..60824488 Genome browser AA seq 197 aa AA seqDB search MSAEEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDTGSYNEIHKFHTQILRVKDRDDFPMVLVGN KADLDQSRAISREEAQGFARENRIHYMEASAKNRYNVDEAFLEVVRAIRKFQETESPPLP ANHTGKRKSGGCPCTLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgaggaggagagattcaaactggtcgtcgtgggcgggggcggtgtggggaaa agcgccttgaccatacaattcattcagtcatactttgtatcggattatgaccccaccatc gaggactcctacaccaagatatgcacagtggatgggaaagagacacgattagacatcttg gacacagcaggtcaggaggagtttggggcaatgagggagcagtacatgcgctcaggggaa ggcttcttgctggtgttcgctctgaatgacactggcagttacaatgagatccacaagttc cacacccagatactgagagtgaaggaccgggatgacttccccatggtgctggtggggaac aaggctgacctggaccagtcgagagcgatctccagagaggaggcccagggctttgccaga gagaacaggatccattacatggaggcctcggctaagaaccgctacaacgtagacgaagcc ttcctggaggtggtgcgagctataagaaagtttcaggagactgagagtccccctctacct gcaaaccacacaggaaaacggaagagcggtggctgcccctgcaccctcctttaa

DBGET integrated database retrieval system