Oncorhynchus kisutch (coho salmon): 109898730 Help Entry 109898730         CDS       T09179                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:oki00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109898730  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oki04121]     109898730    03400 DNA repair and recombination proteins [BR:oki03400]     109898730 Ubiquitin system [BR:oki04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      109898730    Cul5 complex      109898730 DNA repair and recombination proteins [BR:oki03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      109898730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  109898730 NCBI-ProteinID:  XP_020349419 Ensembl:  ENSOKIG00005008086 LinkDB All DBs Position LG10:complement(65729374..65733297) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEEQRLYKDDMLLEDSKTLGDC GFTNQTARPQAPGTVGLAFRLGDDAFEQLRVEPFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttctgatgatccggcgtcacaagacgaccatcttcactgatgccaaagag tccactacggtctacgagctgaagcgcatagtggagggtatcctaaagagggcaccggag gaacagaggctgtacaaggatgacatgttgctggaggatagtaagactcttggagactgt ggcttcacaaatcagacagccagacctcaggccccagggactgttggattagctttccgt ctcggtgatgatgcatttgagcagctgagggttgagcccttctccagccccccagagctt cctgatgtcatgaaacctcaggactctggcagcacagccaatgagcaggctgtgcagtga

DBGET integrated database retrieval system