Oncorhynchus kisutch (coho salmon): 109906806 Help Entry 109906806         CDS       T09179                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04060   Cytokine-cytokine receptor interaction oki04218   Cellular senescence oki04620   Toll-like receptor signaling pathway oki04621   NOD-like receptor signaling pathway oki04622   RIG-I-like receptor signaling pathway oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109906806  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109906806  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109906806    04621 NOD-like receptor signaling pathway     109906806    04622 RIG-I-like receptor signaling pathway     109906806  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109906806  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oki04052]     109906806    00536 Glycosaminoglycan binding proteins [BR:oki00536]     109906806 Cytokines and neuropeptides [BR:oki04052]  Cytokines   Chemokines    109906806 Glycosaminoglycan binding proteins [BR:oki00536]  Heparan sulfate / Heparin   Chemokines    109906806 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109906806 NCBI-ProteinID:  XP_020360239 Ensembl:  ENSOKIG00005004409 UniProt:  A0A8C7F2Y4 LinkDB All DBs Position LG15:complement(44888975..44900416) Genome browser AA seq 116 aa AA seqDB search MKMSIRMSDSSIGVLLALLTITEGMSLSNLGSDLRCRCIQMERRRIGKLIDKVEMFPPSS HCKDTEIIATLKGSGKEICLDVSAPWVKKIIEQILAKDKRNSYSPKTWNKRTSKKP NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaagatgagcatcagaatgtcagacagctctatcggtgtgctcctggccctcctgacc atcaccgaggggatgagcctaagtaacttggggtcagacttacgttgtcgctgcatccag atggagaggcgtcggattggtaaactcatcgacaaggtagagatgtttcctcccagctcg cactgcaaagacactgagatcatagccactctgaaggggagcggtaaggagatttgtttg gacgtcagcgctccctgggtcaagaagatcattgagcagatactggccaaggacaagaga aactcatacagcccaaagacctggaataaacgaaccagcaagaagccttga

DBGET integrated database retrieval system