Oncorhynchus kisutch (coho salmon): 109907690 Help Entry 109907690         CDS       T09179                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04382   Cornified envelope formation oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109907690  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109907690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     109907690 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of microglial cells    109907690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 DAXX_hist_bd NNH2 Bcl-2 EH Motif Other DBs NCBI-GeneID:  109907690 NCBI-ProteinID:  XP_020361396 Ensembl:  ENSOKIG00005020627 UniProt:  A0A8C7GUY2 LinkDB All DBs Position LG17:complement(42060661..42063334) Genome browser AA seq 99 aa AA seqDB search MPSELERAMESMITVFHKYAAKEGSGNTLSRRELKDLMENELSGFLKSQKDPATVDKIMK DLDSNGDGEVNFEEFVSLVVGLSIACEQCYQMHKKKMGK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccgtcagaactggaacgtgccatggagtccatgatcaccgtgttccacaagtacgct gctaaggagggcagtggcaacactttgagccgccgtgagctcaaggacctgatggagaac gagctctctggcttcctcaagtctcagaaggacccagccacagtagacaagataatgaag gatctggactctaatggtgatggagaggtgaactttgaggagtttgtttctctagttgtg ggcctgtccatcgcctgtgaacagtgctaccagatgcacaagaagaagatggggaagtga

DBGET integrated database retrieval system