Oncorhynchus kisutch (coho salmon): 109908655 Help Entry 109908655         CDS       T09179                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04068   FoxO signaling pathway oki04081   Hormone signaling oki04114   Oocyte meiosis oki04140   Autophagy - animal oki04150   mTOR signaling pathway oki04810   Regulation of actin cytoskeleton oki04910   Insulin signaling pathway oki04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109908655    04068 FoxO signaling pathway     109908655    04150 mTOR signaling pathway     109908655   09133 Signaling molecules and interaction    04081 Hormone signaling     109908655  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109908655   09143 Cell growth and death    04114 Oocyte meiosis     109908655   09142 Cell motility    04810 Regulation of actin cytoskeleton     109908655  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     109908655    04914 Progesterone-mediated oocyte maturation     109908655  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oki04052]     109908655 Cytokines and neuropeptides [BR:oki04052]  Neuropeptides   Unclassified    109908655 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta NrfD_2 Motif Other DBs NCBI-GeneID:  109908655 NCBI-ProteinID:  XP_020362902 LinkDB All DBs Position LG15:16177495..16180114 Genome browser AA seq 115 aa AA seqDB search MAVVVWALSVLLLLVLSSPGVCSAPSAQHLCGSHLVDALYLVCGEQGFFYNPHRIPRDLL LQHLIGFLSRKSRQGWRVKQERPWKDHEDQKVKRGIVEQCCHKPCSFSHLQSYCD NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggctgtggtagtatgggccctgtctgttctgttactgctggtcctgtcttccccgggg gtctgctcagctcccagcgcccagcacctgtgtggctcacacctggtggatgccctctac ctggtctgtggggaacaagggttcttctataacccccacagaatccccagagacctactc ctgcaacaccttatagggttcctgtctagaaagagcagacagggttggagggtgaagcag gaacgtccatggaaggaccatgaagaccagaaggtgaaaagaggcattgtggaacagtgc tgtcataagccatgtagcttcagccacctgcagagctactgcgactga

DBGET integrated database retrieval system