Oncorhynchus kisutch (coho salmon): 116361131 Help Entry 116361131         CDS       T09179                                  Name (RefSeq) fibroblast growth factor 7-like   KO K04358   fibroblast growth factor Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04020   Calcium signaling pathway oki04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116361131    04020 Calcium signaling pathway     116361131  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     116361131  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oki04052]     116361131    00536 Glycosaminoglycan binding proteins [BR:oki00536]     116361131 Cytokines and neuropeptides [BR:oki04052]  Cytokines   Growth factors (RTK binding)    116361131 Glycosaminoglycan binding proteins [BR:oki00536]  Heparan sulfate / Heparin   Growth factors/receptors    116361131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  116361131 NCBI-ProteinID:  XP_031671709 LinkDB All DBs Position LG3:78209761..78215174 Genome browser AA seq 111 aa AA seqDB search MSRLGILEVRTVSEGGVLAIKGVKSQYYISMNRTGLLQGKKIYNENCNFKEIFLENYFNA YSSVKSSRDDKEMFIALSQKGRPLRGKKTRREHIASHFIPMKCREEERTGV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgtcacgcctgggtatcctggaggtccgtacggtgtccgagggaggagtgttagctatc aaaggagtgaagagtcagtactatatctccatgaacaggactggcctgctgcaaggcaag aaaatctacaatgagaactgcaacttcaaggagattttcctagaaaactacttcaacgct tactcgtctgttaagtcgagtagagacgacaaggagatgttcattgctctgtctcaaaag ggcagaccgctgagagggaagaagaccaggagggaacacatcgcctcccacttcattccc atgaaatgcagagaggaggagaggactggcgtctga

DBGET integrated database retrieval system