Oncorhynchus kisutch (coho salmon): 116371700 Help Entry 116371700         CDS       T09179                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04621   NOD-like receptor signaling pathway oki05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oki00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     116371700  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116371700  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:oki03110]     116371700 Chaperones and folding catalysts [BR:oki03110]  Protein folding catalysts   Protein disulfide isomerase    116371700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin AhpC-TSA OST3_OST6 Thioredoxin_8 DIM1 Redoxin Thioredoxin_7 Thioredoxin_2 Thioredoxin_9 T4_deiodinase Motif Other DBs NCBI-GeneID:  116371700 NCBI-ProteinID:  XP_031676457 Ensembl:  ENSOKIG00005042307 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MIIIIEDKEGFDKALEEAGDKLVVVDFTATWCGPCQSIAPFFKGLSENYQSVVFLKVDVD DAPDVASFCDIKCMPTFHFYKDQKKVEEFSGSNQAKLEELVNTHK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgatcattataatcgaagataaggagggcttcgacaaggccctggaggaggcaggagat aaactggtggtggtggacttcacagccacgtggtgcggcccctgtcagagcatcgctcct ttcttcaagggtctgtctgagaattatcagagtgtggtcttcctgaaggttgacgtggac gacgcaccggatgtggccagtttctgtgacatcaagtgtatgccaacattccacttctac aaggaccagaagaaggtggaggagttctcagggtccaatcaggccaaactggaggagctg gtcaacactcacaaataa

DBGET integrated database retrieval system