Owariibacterium komagatae: Ruko_07470 Help Entry Ruko_07470        CDS       T10753                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism oko  Owariibacterium komagatae Pathway oko00998   Biosynthesis of various antibiotics oko01100   Metabolic pathways oko01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:oko00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ruko_07470    00074 Mycolic acid biosynthesis     Ruko_07470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ruko_07470 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BFJ84330 LinkDB All DBs Position 769325..769567 Genome browser AA seq 80 aa AA seqDB search MDSNAIFEAVQQIFRDNFDDEELVLTRETCADDIEDWDSLEQINLLTAIEKKFGLKFGLA DVRDLQNVGDLLDLIERMTA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggacagcaatgcgatttttgaagcagtgcagcaaattttccgcgataattttgacgac gaggaactggttctgacccgcgagacctgcgccgacgacattgaggactgggacagcctg gagcagatcaatctgctgacagcgattgagaaaaagttcggtctgaagttcggtctggcc gatgtgcgcgatctgcagaatgtgggcgacctgctggatctgattgaacgcatgaccgcc tga

DBGET integrated database retrieval system