Oryzias latipes (Japanese medaka): 101155699 Help Entry 101155699         CDS       T02443                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04382   Cornified envelope formation ola05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ola00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     101155699  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101155699  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101155699 Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of microglial cells    101155699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg YqeY EH Cas9_REC Bcl-2 DUF7260 Motif Other DBs NCBI-GeneID:  101155699 NCBI-ProteinID:  XP_004073747 UniProt:  H2L4G3 A0A3P9KYZ8 LinkDB All DBs Position 11:1217521..1218642 Genome browser AA seq 96 aa AA seqDB search MPSELENAMESLIKVFHRYAKDNQLNRRELRELMENELSNFLKAQKDPAAVDKIMKDLDA NGDGQVDFEEFVSLVVGLSVACEQCYQMEMKKRGKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagaacgccatggagtccctcatcaaggtcttccaccgctacgcc aaagacaaccagctcaaccggcgggagctccgggagctgatggagaacgagctctccaac ttcctcaaggctcagaaggaccccgccgccgtagacaagatcatgaaggacctggacgcc aacggggacggccaagtggactttgaggagtttgtgtctttggttgttggactgtcggtc gcctgtgagcaatgttaccagatggagatgaagaagcgagggaagaagtga

DBGET integrated database retrieval system