Oryzias latipes (Japanese medaka): 101156596 Help Entry 101156596         CDS       T02443                                  Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism ola  Oryzias latipes (Japanese medaka) Pathway ola03410   Base excision repair ola04140   Autophagy - animal ola04217   Necroptosis Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     101156596  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101156596   09143 Cell growth and death    04217 Necroptosis     101156596  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ola03036]     101156596    03400 DNA repair and recombination proteins [BR:ola03400]     101156596   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101156596 Chromosome and associated proteins [BR:ola03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     101156596 DNA repair and recombination proteins [BR:ola03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      101156596    MMR (mismatch excision repair)     Other MMR factors      101156596 Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101156596 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 Ets Motif Other DBs NCBI-GeneID:  101156596 NCBI-ProteinID:  XP_004075350 UniProt:  H2LG42 LinkDB All DBs Position 13:8849049..8851531 Genome browser AA seq 194 aa AA seqDB search MVKDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSPKEKGKFE DMAKQDKVRYEREMKNYVPPKGQKKKRFKDPNAPKRPPSAFFLFCADFRPKIKSESPGLS IGDTAKKLGEMWNSSSAEEKQPYEKKAAKLKEKYDKDIVAYRTKGKVDSESASAADEEEE GEEEEEEEEEDEDD NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggatccaaaaaagccaaggggcaaaatgtcctcatatgcttactttgtgcaa acatgccgagaggagcacaagaagaaacaccctgatgcttcagtcaatttttcggaattc tccaagaaatgctctgagcgatggaagacaatgtcacctaaagagaaaggcaagtttgaa gatatggccaaacaagacaaggtgcgttatgagagagaaatgaagaattatgtacccccc aaggggcagaagaagaaacgattcaaggacccaaatgctccaaagagaccgccgtctgct ttctttcttttctgtgcagattttcgccccaaaataaaaagtgaaagccccggactttcc attggcgacaccgccaagaaactcggggagatgtggaacagctcgtctgcggaggagaag cagccgtacgagaagaaggcggccaaattgaaggagaaatatgacaaagacatcgttgct taccgtacaaaaggcaaagtcgattcagaatcagcttctgccgctgatgaagaggaagaa ggagaggaggaggaggaggaagaggaagaagatgaggatgattag

DBGET integrated database retrieval system