Oryzias latipes (Japanese medaka): 101156793 Help Entry 101156793         CDS       T02443                                  Name (RefSeq) 14-3-3 protein gamma-2   KO K16198   14-3-3 protein gamma/eta Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04110   Cell cycle ola04114   Oocyte meiosis Brite KEGG Orthology (KO) [BR:ola00001]  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101156793    04114 Oocyte meiosis     101156793  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ola01009]     101156793   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ola03400]     101156793   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101156793 Protein phosphatases and associated proteins [BR:ola01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101156793 DNA repair and recombination proteins [BR:ola03400]  Eukaryotic type   Check point factors    Other check point factors     101156793 Exosome [BR:ola04147]  Exosomal proteins   Proteins found in most exosomes    101156793 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  14-3-3 Orbi_VP5 zf-CRD SF3A2 Nup49_C FlaC_arch Motif Other DBs NCBI-GeneID:  101156793 NCBI-ProteinID:  XP_023818560 LinkDB All DBs Position 14:complement(21390738..21411131) Genome browser AA seq 142 aa AA seqDB search MVDREQLVQKARLAEQAERYDDMAAAMKSVTELNEALSNEERNLLSVAYKNVVGARRSSW RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLNLLDNFLIKNCNETQHESK VRIQEMCYNCRVPQVKTLLSLD NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggtcgaccgtgagcaactggtgcagaaagcccggctggccgagcaggcggagcggtat gatgatatggcagctgccatgaagtcggtcacagagctgaatgaagcactatccaacgag gagaggaacctcctctctgtggcctacaagaacgtggttggagcgaggcgttcctcctgg cgcgtcatctccagcatcgagcaaaagacgtcggcagacggcaacgagaagaagatcgag atggttcgcgcctatcgggaaaagatcgagaaggagctggaggccgtgtgccaggacgtg ctcaacctcctcgacaacttcctgatcaagaactgcaacgagacgcagcacgagagcaaa gtacgcattcaggagatgtgctacaactgtcgggttcctcaggtcaagacacttctgagc ctggactaa

DBGET integrated database retrieval system