Oryzias latipes (Japanese medaka): 101157689 Help Entry 101157689         CDS       T02443                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04137   Mitophagy - animal ola04140   Autophagy - animal ola04144   Endocytosis ola04145   Phagosome ola04148   Efferocytosis ola05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ola00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101157689    04145 Phagosome     101157689    04140 Autophagy - animal     101157689    04137 Mitophagy - animal     101157689    04148 Efferocytosis     101157689  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101157689  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ola04131]     101157689   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101157689    04031 GTP-binding proteins [BR:ola04031]     101157689 Membrane trafficking [BR:ola04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     101157689 Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101157689   Exosomal proteins of other body fluids (saliva and urine)    101157689   Exosomal proteins of colorectal cancer cells    101157689   Exosomal proteins of bladder cancer cells    101157689 GTP-binding proteins [BR:ola04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     101157689 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab MCM Motif Other DBs NCBI-GeneID:  101157689 NCBI-ProteinID:  XP_004069352 UniProt:  A0A3B3H7L3 LinkDB All DBs Position 5:complement(30976792..30981281) Genome browser AA seq 206 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLRSEPPKPSSEPCSC NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagtgctgcttaaagtcatcatccttggggattctggagttggg aagacctcattaatgaatcagtatgtgaacaagaagttcagcaaccagtacaaagccaca ataggtgctgatttcctgacaaaagaagtcatggtggacgacagactcgtcacaatgcag atttgggacacggccggtcaggagaggttccagtctctcggcgtggcgttctaccgcgga gcagactgctgtgttttggtgttcgatgtgacggcacccaacactttcaagaccctagac agctggagagacgagttcttgatccaggctagtccacgagacccagagaacttccctttt gtggtgctgggcaacaagattgacttggagaacagacaggtaacaaccaaacgagcacag gcttggtgtcagagtaagaacaacatcccatattttgagaccagtgccaaagaggccatc aatgttgagcaggccttccagacgattgcacgcaacgctcttaaacaggaaaccgaagtg gagttgtacaacgagttccccgagccgatcaaactgagaagcgagccgcccaagccgtcg tcagagccctgcagctgctga

DBGET integrated database retrieval system