Oryzias latipes (Japanese medaka): 101158002 Help Entry 101158002         CDS       T02443                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism ola  Oryzias latipes (Japanese medaka) Pathway ola04814   Motor proteins ola05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ola00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     101158002  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101158002  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ola03037]     101158002    04812 Cytoskeleton proteins [BR:ola04812]     101158002 Cilium and associated proteins [BR:ola03037]  Motile cilia and associated proteins   Dynein arm    101158002 Cytoskeleton proteins [BR:ola04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      101158002 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  101158002 NCBI-ProteinID:  XP_004066510 LinkDB All DBs Position 2:complement(11418900..11422176) Genome browser AA seq 114 aa AA seqDB search MEDFHNGNEGSFNSEETDGIVKECIENVVGGDDYSANLVNKWTAGIVERCLTQLVKQGKP YKYIVTCAVMQKTGAGLHTANSCYWDTAMDGSTTVRWENRTMYCVVSVFAVAVA NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaagattttcataacggaaacgagggctcttttaactccgaggaaactgatggaatc gtcaaagagtgcatcgagaacgtggtgggaggcgacgactacagcgccaatttggtgaac aaatggacggccggcatcgtggagcgctgcctcacccagctggtcaaacaggggaagccg tacaagtatatcgtgacgtgcgctgtgatgcagaagaccggcgccggacttcacacagcc aactcctgttactgggacactgccatggacggaagcaccaccgtaaggtgggaaaaccgc accatgtactgcgtggtcagcgtgtttgcggtggccgttgcctag

DBGET integrated database retrieval system